PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2280s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 357aa    MW: 39558.4 Da    PI: 7.1812
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2280s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32215270156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  Araha.2280s0005.1.p 215 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 270
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.821212272IPR017930Myb domain
SuperFamilySSF466891.61E-17212273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-28213273IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27215270IPR006447Myb domain, plants
PfamPF002495.7E-8217268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMVEMDYAKK MQKCHEYVEA LEEEQKKIQV FQRELPLCLE LVTQAIEACR KELSGTTTTS  60
EQCSEQTISV CGGPVFEEFI PIKKRSLCEE EEEDGEHESS PELEQIGNNK KSDWLRSVQL  120
WTPSPDLNPK EERVVKKAKV VEVTPKSGAF QPFQKEKKRV LETDLQPAVK VASSTPATTT  180
SSTTETGGAK SELVKVGEEQ RQIEQQQSQS QTHRKQRRCW SPELHRRFLN ALQQLGGSHV  240
ATPKQIRDHM KVDGLTNDEV KSHLQKYRLH TRRPAAASVA AQSNGNPQQP QFVVVGGIWV  300
PSPQDFPPPS DVANNGGVYA PVAVAQSPKR SVERSCNSPA ASSSTNTNTN TSTPVS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638860.0AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0912410.0AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887197.10.0hypothetical protein ARALYDRAFT_475994
TrEMBLD7KWE90.0D7KWE9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.2__1124__AT1G68670.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-152G2-like family protein